(data stored in ACNUC7421 zone)

EMBL: CP001402.PE533

CP001402.PE533       Location/Qualifiers
FT   CDS             471987..473627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0541"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41169"
FT                   /db_xref="GOA:C4KEH2"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR034184"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEH2"
FT                   /protein_id="ACR41169.1"
FT                   /translation="MSKGNSPFSYISSAYGKNHFNIDKPLQKILEYFDVKADFSKLGEF
FT                   AGGELYEIAEHVDKRARPIHVMWSVNGERVDEVWIDPSLRAAIKRLIKDFDINKFPYKE
FT                   ENWHKHYASIYLVSDPGIACILTITNQTAYALYKYGSEELKKYVPYLIGDSDELLFGAT
FT                   WFTEIQGGSDLGSNLVEAEFNGKYWLLKGNTKYFASGVGLADLALVSARPMGSKSGAKG
FT                   LSLFLVPKKNNKGEKNFLIRRLKRKSGTNSVPTGEVEFNSSEAYLIGEKEYGIYYITED
FT                   LMVSRLSNAVGALGIARKSFLESYYYSQSRKAFGKALIEHPLIQKDLLEMELMIEGGMV
FT                   VTFKAIDQFQKSWKAMPPFYNEQYHYARLLTHISKHITAEIASQVSRMAMEIHGGIGFL
FT                   EEFPIERLHREALITPIWEGTGNIQALEMLEAMVKKEAHRQLIRDLEGIVNEAKDEIAS
FT                   KTLDFIKDKATTLLTYREYEMQFYSKDLLLTLGHGISVILLSHMGRKLGIERFTMLSKI
FT                   YYERFLMGRSILRDYISEIRELINMEEMK"
     MSKGNSPFSY ISSAYGKNHF NIDKPLQKIL EYFDVKADFS KLGEFAGGEL YEIAEHVDKR        60
     ARPIHVMWSV NGERVDEVWI DPSLRAAIKR LIKDFDINKF PYKEENWHKH YASIYLVSDP       120
     GIACILTITN QTAYALYKYG SEELKKYVPY LIGDSDELLF GATWFTEIQG GSDLGSNLVE       180
     AEFNGKYWLL KGNTKYFASG VGLADLALVS ARPMGSKSGA KGLSLFLVPK KNNKGEKNFL       240
     IRRLKRKSGT NSVPTGEVEF NSSEAYLIGE KEYGIYYITE DLMVSRLSNA VGALGIARKS       300
     FLESYYYSQS RKAFGKALIE HPLIQKDLLE MELMIEGGMV VTFKAIDQFQ KSWKAMPPFY       360
     NEQYHYARLL THISKHITAE IASQVSRMAM EIHGGIGFLE EFPIERLHRE ALITPIWEGT       420
     GNIQALEMLE AMVKKEAHRQ LIRDLEGIVN EAKDEIASKT LDFIKDKATT LLTYREYEMQ       480
     FYSKDLLLTL GHGISVILLS HMGRKLGIER FTMLSKIYYE RFLMGRSILR DYISEIRELI       540
     NMEEMK                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page