(data stored in ACNUC7421 zone)

EMBL: CP001402.PE536

CP001402.PE536       Location/Qualifiers
FT   CDS             476972..477514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0544"
FT                   /product="protein of unknown function DUF105"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41172"
FT                   /db_xref="InterPro:IPR002808"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEH5"
FT                   /protein_id="ACR41172.1"
FT                   /translation="MEPKIVRFDLGKEYIILTSALYPEGIIRVNQICSIFVDKSYCSGN
FT                   PWGDVINWCPSKSAIIFMTAAKNYTFKETDWGKFFISAGIGRSGEDAGCTINIGVFVDK
FT                   GLNINGLVDLIRTVTEAKAGALRDLGYKFTGTVSDAIAVGSLPGNEYFIGPGTELGKKI
FT                   AYDIRNTIVELLFKGDD"
     MEPKIVRFDL GKEYIILTSA LYPEGIIRVN QICSIFVDKS YCSGNPWGDV INWCPSKSAI        60
     IFMTAAKNYT FKETDWGKFF ISAGIGRSGE DAGCTINIGV FVDKGLNING LVDLIRTVTE       120
     AKAGALRDLG YKFTGTVSDA IAVGSLPGNE YFIGPGTELG KKIAYDIRNT IVELLFKGDD       180
//

If you have problems or comments...

PBIL Back to PBIL home page