(data stored in ACNUC7421 zone)

EMBL: CP001402.PE541

CP001402.PE541       Location/Qualifiers
FT   CDS             481875..482786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41177"
FT                   /db_xref="GOA:C4KEI0"
FT                   /db_xref="InterPro:IPR000832"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEI0"
FT                   /protein_id="ACR41177.1"
FT                   /translation="MDIFQLQGLFLVLSAILGYFLHNRLSVRIVSFVNNWINLPLIFLV
FT                   TYLQRGFEVSDAKIFLTSVIYNFLMFAIVLYLTREIESFIRGAVLINSIFMNTINLPFS
FT                   ILLAFRGNYEISATVAVSMATLRLPIAMIIFTYLNKGISVIHNTTNNSIIRTNLSRYLP
FT                   VITFLIGGSLHYVVGSVINVDVVNTINLILILIVLYEFGYQIRRVIGEMRIKDVTSKPY
FT                   MIIYISRILISPILIFLILISLGITSKIIIEQVMVTAIMAPAITNVVWARVYGFGTEII
FT                   VKSTLILTPISTIIAIIFLILY"
     MDIFQLQGLF LVLSAILGYF LHNRLSVRIV SFVNNWINLP LIFLVTYLQR GFEVSDAKIF        60
     LTSVIYNFLM FAIVLYLTRE IESFIRGAVL INSIFMNTIN LPFSILLAFR GNYEISATVA       120
     VSMATLRLPI AMIIFTYLNK GISVIHNTTN NSIIRTNLSR YLPVITFLIG GSLHYVVGSV       180
     INVDVVNTIN LILILIVLYE FGYQIRRVIG EMRIKDVTSK PYMIIYISRI LISPILIFLI       240
     LISLGITSKI IIEQVMVTAI MAPAITNVVW ARVYGFGTEI IVKSTLILTP ISTIIAIIFL       300
     ILY                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page