(data stored in ACNUC7421 zone)

EMBL: CP001402.PE542

CP001402.PE542       Location/Qualifiers
FT   CDS             482965..483816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0551"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41178"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEI1"
FT                   /protein_id="ACR41178.1"
FT                   /translation="MYSTELTLNSPIWIVRKFLMDPLFISGVSGHISILKFKDKQKDEY
FT                   IMGDRIRELSAPTDEFIALYILLRTNKDFKYTEGIFNGPKITMQSIKYSGMSDDGKLEF
FT                   TIEFMPKSLGDTQTRLYVATNVKYNDSLLDKMLGKSAVDFAKHIVEDHFATYARVYFPS
FT                   LYGDIIRSLTNKETDKEKTTQGLSLTPLFEFSGDATSILSKINEMVSQLDLGLIKVNFG
FT                   KVNCNIIVQNKDMKRAICRSDSNVKAGFEALSLIISAKGQGKMEVYSVKMEDLIDTLYT
FT                   LA"
     MYSTELTLNS PIWIVRKFLM DPLFISGVSG HISILKFKDK QKDEYIMGDR IRELSAPTDE        60
     FIALYILLRT NKDFKYTEGI FNGPKITMQS IKYSGMSDDG KLEFTIEFMP KSLGDTQTRL       120
     YVATNVKYND SLLDKMLGKS AVDFAKHIVE DHFATYARVY FPSLYGDIIR SLTNKETDKE       180
     KTTQGLSLTP LFEFSGDATS ILSKINEMVS QLDLGLIKVN FGKVNCNIIV QNKDMKRAIC       240
     RSDSNVKAGF EALSLIISAK GQGKMEVYSV KMEDLIDTLY TLA                         283
//

If you have problems or comments...

PBIL Back to PBIL home page