(data stored in ACNUC7421 zone)

EMBL: CP001402.PE544

CP001402.PE544       Location/Qualifiers
FT   CDS             complement(485532..486425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0553"
FT                   /product="Protein of unknown function DUF973"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41180"
FT                   /db_xref="GOA:C4KEI3"
FT                   /db_xref="InterPro:IPR009321"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEI3"
FT                   /protein_id="ACR41180.1"
FT                   /translation="MSQQNTELEGIGKLRSGSLFMILAVLLAAIGVLVIISAGMLGGMF
FT                   SAASGNVSGVIASGIGLLVGIAIVILIGAIIGLIGILRIRSGFGILKSLGRDVGIGEIG
FT                   TTLYLVGLIIIIIGALLTIVLIGFPILILGEIIALIGGILIGIGFYKVGEIYNEGLVKI
FT                   GGILIVIPIDLINFVGFILAYVGLGKVRPLPTVAQQPLVPQVYQVGQGTIRNNGYAYIT
FT                   LYSSTPASIISAKIEGANIMSSAINPTVLQIGNNEVTIFFGNVQSLAPNTTYIITLTIN
FT                   IGGNIINISTTAVYQP"
     MSQQNTELEG IGKLRSGSLF MILAVLLAAI GVLVIISAGM LGGMFSAASG NVSGVIASGI        60
     GLLVGIAIVI LIGAIIGLIG ILRIRSGFGI LKSLGRDVGI GEIGTTLYLV GLIIIIIGAL       120
     LTIVLIGFPI LILGEIIALI GGILIGIGFY KVGEIYNEGL VKIGGILIVI PIDLINFVGF       180
     ILAYVGLGKV RPLPTVAQQP LVPQVYQVGQ GTIRNNGYAY ITLYSSTPAS IISAKIEGAN       240
     IMSSAINPTV LQIGNNEVTI FFGNVQSLAP NTTYIITLTI NIGGNIINIS TTAVYQP          297
//

If you have problems or comments...

PBIL Back to PBIL home page