(data stored in ACNUC7421 zone)

EMBL: CP001402.PE546

CP001402.PE546       Location/Qualifiers
FT   CDS             491770..492456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0557"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41182"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEI5"
FT                   /protein_id="ACR41182.1"
FT                   /translation="MSTQVSNPYMQFGNTQPCKHWGFVVKVDQCLGCDACVAACTIENQ
FT                   TPFWRGLFRTHVEDLELGEYPNTQRVFVPRLCMQCENPPCYYVCPTGATQIVVGGIVVV
FT                   DEYKCMGCLYCVEACPYGARYFYTYEDIEKSKEYFGLNSIHVVPHVDKCTFCYGTAPEG
FT                   TYTPACVRTCPGHARVFGCLDDPNSEVSILVNTGQAVVLNPELDVQPKVFYVFNRQLGR
FT                   GGGGNS"
     MSTQVSNPYM QFGNTQPCKH WGFVVKVDQC LGCDACVAAC TIENQTPFWR GLFRTHVEDL        60
     ELGEYPNTQR VFVPRLCMQC ENPPCYYVCP TGATQIVVGG IVVVDEYKCM GCLYCVEACP       120
     YGARYFYTYE DIEKSKEYFG LNSIHVVPHV DKCTFCYGTA PEGTYTPACV RTCPGHARVF       180
     GCLDDPNSEV SILVNTGQAV VLNPELDVQP KVFYVFNRQL GRGGGGNS                    228
//

If you have problems or comments...

PBIL Back to PBIL home page