(data stored in ACNUC7421 zone)

EMBL: CP001402.PE548

CP001402.PE548       Location/Qualifiers
FT   CDS             493755..495122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0559"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41184"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEI7"
FT                   /protein_id="ACR41184.1"
FT                   /translation="MTSLFYSPLIKYRVDVLPSSELKKENINTKALVVIGDGIDREKIS
FT                   EDLELNPLLVRIVDKDSSKEEVEYNKVVLENAWLADLAPVEEIKSIDRRSLLRGEVKKA
FT                   KKVDKPIYLSEYCNGLYKACNVCEFSCPYNAIKVDKKTGVNIDYIKCTSCGLCVASCPV
FT                   SAIQFPSLSQNSIFELAKVKGEKRITCYKNTKNRGVKIPCLAMLSEVDIVLLKSSGNLT
FT                   FECPGCEFQDNLKHFIEVIKEYNERIGGISFYSPSEKIEAKETKELNTTPQSFYNRAEA
FT                   RRNISDELPYILFDVSIDNNRCTLCESCVNWCPTSALKLRRDSGVEEIDFDPKRCIGCN
FT                   LCVNVCPESCKLEEGKTSEIPPNIASLTKVIKVEKSKSVNKEVRKLVGDELVRCRVCGA
FT                   PIGSRKSLNHVKKIMIEKGASCEDEWLERCPKHRVEYAFQKQFSFNARFKPRGDLR"
     MTSLFYSPLI KYRVDVLPSS ELKKENINTK ALVVIGDGID REKISEDLEL NPLLVRIVDK        60
     DSSKEEVEYN KVVLENAWLA DLAPVEEIKS IDRRSLLRGE VKKAKKVDKP IYLSEYCNGL       120
     YKACNVCEFS CPYNAIKVDK KTGVNIDYIK CTSCGLCVAS CPVSAIQFPS LSQNSIFELA       180
     KVKGEKRITC YKNTKNRGVK IPCLAMLSEV DIVLLKSSGN LTFECPGCEF QDNLKHFIEV       240
     IKEYNERIGG ISFYSPSEKI EAKETKELNT TPQSFYNRAE ARRNISDELP YILFDVSIDN       300
     NRCTLCESCV NWCPTSALKL RRDSGVEEID FDPKRCIGCN LCVNVCPESC KLEEGKTSEI       360
     PPNIASLTKV IKVEKSKSVN KEVRKLVGDE LVRCRVCGAP IGSRKSLNHV KKIMIEKGAS       420
     CEDEWLERCP KHRVEYAFQK QFSFNARFKP RGDLR                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page