(data stored in ACNUC7421 zone)

EMBL: CP001402.PE549

CP001402.PE549       Location/Qualifiers
FT   CDS             495119..495661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0560"
FT                   /product="cytoplasmic chaperone TorD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41185"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEI8"
FT                   /protein_id="ACR41185.1"
FT                   /translation="MKSLSTDFKIFSFLFLSPRYIKDVKGFVEEIKDKPYYNTLKQIIQ
FT                   LTETNYDKVATEFTSCFINDYKHVKCPPYESWYRERAVYGISAQRVLEEYIEYGIYPKK
FT                   QLADHISTELEFVSFLLFVEQEDEAKKFIKEHIVSWVPKLIEDILVNSKGEYTKLLGIA
FT                   LKQFLDYAIQNIFVVNR"
     MKSLSTDFKI FSFLFLSPRY IKDVKGFVEE IKDKPYYNTL KQIIQLTETN YDKVATEFTS        60
     CFINDYKHVK CPPYESWYRE RAVYGISAQR VLEEYIEYGI YPKKQLADHI STELEFVSFL       120
     LFVEQEDEAK KFIKEHIVSW VPKLIEDILV NSKGEYTKLL GIALKQFLDY AIQNIFVVNR       180
//

If you have problems or comments...

PBIL Back to PBIL home page