(data stored in ACNUC7421 zone)

EMBL: CP001402.PE55

CP001402.PE55        Location/Qualifiers
FT   CDS             45987..46313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40691"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJH1"
FT                   /protein_id="ACR40691.1"
FT                   /translation="MIIFYAIGERDRAKELVRIITKTRWKTISKHAIKIASSSIGPSVV
FT                   IFKPTMAGLAVALWLKQRAEELGMTSAVGWFQPINQIPPQVEDAIRTDLNKILVKKLEV
FT                   PWSP"
     MIIFYAIGER DRAKELVRII TKTRWKTISK HAIKIASSSI GPSVVIFKPT MAGLAVALWL        60
     KQRAEELGMT SAVGWFQPIN QIPPQVEDAI RTDLNKILVK KLEVPWSP                    108
//

If you have problems or comments...

PBIL Back to PBIL home page