(data stored in ACNUC7421 zone)

EMBL: CP001402.PE553

CP001402.PE553       Location/Qualifiers
FT   CDS             498795..499142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41189"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEJ2"
FT                   /protein_id="ACR41189.1"
FT                   /translation="MPILQAKKRKEHENKREGNKGRRTTRKNHMGSNYIEEKFNVKISY
FT                   SLENSEKEVKNTLQDRQEETNRCRLRERFRGVIKKGVKVFFMDEFGIRHDPSRVYMLLG
FT                   LIIQVLMFSLV"
     MPILQAKKRK EHENKREGNK GRRTTRKNHM GSNYIEEKFN VKISYSLENS EKEVKNTLQD        60
     RQEETNRCRL RERFRGVIKK GVKVFFMDEF GIRHDPSRVY MLLGLIIQVL MFSLV            115
//

If you have problems or comments...

PBIL Back to PBIL home page