(data stored in ACNUC7421 zone)

EMBL: CP001402.PE554

CP001402.PE554       Location/Qualifiers
FT   CDS             499369..499509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0565"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41190"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEJ3"
FT                   /protein_id="ACR41190.1"
FT                   /translation="MLCSRIEDEFYYLVSKDNYTGYWINKFHDVLEDLEEGISMGKFSH
FT                   F"
     MLCSRIEDEF YYLVSKDNYT GYWINKFHDV LEDLEEGISM GKFSHF                       46
//

If you have problems or comments...

PBIL Back to PBIL home page