(data stored in ACNUC7421 zone)

EMBL: CP001402.PE555

CP001402.PE555       Location/Qualifiers
FT   CDS             complement(499778..502087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41191"
FT                   /db_xref="GOA:C4KEJ4"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEJ4"
FT                   /protein_id="ACR41191.1"
FT                   /translation="MPSSSASGLTIQVNVIEDAKALAEYMGVSGMKYELIKVTIINDRN
FT                   SPLLLYPQNFTLIGSDDNTYTEVSVNNQYVSTIKPTSLGSGQSIIGFIAFLIPYGVQPK
FT                   TLEYPGISISLTNVRTLYLSVINVTFMSNDSEVKVLLNGNPSTVLVGVNGQNETLKLQV
FT                   QSYHNSLPVILNKIIVSGNLMLIRYSYLPLVLAPEQSYSVDAEVSFTNSSIYGTAQLEF
FT                   YTSINSTVYSGIVNALVNDTVYAINEGVLGESYLAYNVTVSYGGGSIFILNPSQFVLIT
FT                   NSGNYSAQTVYLPGVPSSSKTVSITSSGKAVETLIFKVPTTSKPLVLEYVSHNGQIAFR
FT                   FNAYTSVTENVLFINHFLGFTNDSKVSVNNIFLGNSITGSYYNSGYYLLSTEKIPVIVY
FT                   ITNNHGQVPVEAQDISIKGPATVFTQNYTGTYILQGQTNVYQIILNMNNISYIGNITIS
FT                   LDTSFGSNLYNISVLDVINASAFGQYLASSGGSQGLTFIVYNISLYYQGPGKFNFNPAN
FT                   FVLVTSQGSYTYYNYVIPNGVANGWFDPGARISDWIPGLPTPFFDRVIPTPGMQSSTLL
FT                   HGYGTHGYLVFGIPTSAIIEKLIYKTSNNLTVFSVNANIKANEYISGVPVVVKVTFNNG
FT                   FGNLTATTNEVVFGVDGYNGYTYYIYGKYMAGNEIGPGGVTGVNVVYPSEPPIKVYTSE
FT                   VKTTYDYYYQIPIQFLQFNQSYWSNSSILNVHIYDIPKNSYMSGGNNLTISIVNLVLQL
FT                   LLVDTIIPIIIYLNLK"
     MPSSSASGLT IQVNVIEDAK ALAEYMGVSG MKYELIKVTI INDRNSPLLL YPQNFTLIGS        60
     DDNTYTEVSV NNQYVSTIKP TSLGSGQSII GFIAFLIPYG VQPKTLEYPG ISISLTNVRT       120
     LYLSVINVTF MSNDSEVKVL LNGNPSTVLV GVNGQNETLK LQVQSYHNSL PVILNKIIVS       180
     GNLMLIRYSY LPLVLAPEQS YSVDAEVSFT NSSIYGTAQL EFYTSINSTV YSGIVNALVN       240
     DTVYAINEGV LGESYLAYNV TVSYGGGSIF ILNPSQFVLI TNSGNYSAQT VYLPGVPSSS       300
     KTVSITSSGK AVETLIFKVP TTSKPLVLEY VSHNGQIAFR FNAYTSVTEN VLFINHFLGF       360
     TNDSKVSVNN IFLGNSITGS YYNSGYYLLS TEKIPVIVYI TNNHGQVPVE AQDISIKGPA       420
     TVFTQNYTGT YILQGQTNVY QIILNMNNIS YIGNITISLD TSFGSNLYNI SVLDVINASA       480
     FGQYLASSGG SQGLTFIVYN ISLYYQGPGK FNFNPANFVL VTSQGSYTYY NYVIPNGVAN       540
     GWFDPGARIS DWIPGLPTPF FDRVIPTPGM QSSTLLHGYG THGYLVFGIP TSAIIEKLIY       600
     KTSNNLTVFS VNANIKANEY ISGVPVVVKV TFNNGFGNLT ATTNEVVFGV DGYNGYTYYI       660
     YGKYMAGNEI GPGGVTGVNV VYPSEPPIKV YTSEVKTTYD YYYQIPIQFL QFNQSYWSNS       720
     SILNVHIYDI PKNSYMSGGN NLTISIVNLV LQLLLVDTII PIIIYLNLK                   769
//

If you have problems or comments...

PBIL Back to PBIL home page