(data stored in ACNUC7421 zone)

EMBL: CP001402.PE556

CP001402.PE556       Location/Qualifiers
FT   CDS             502524..506990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0567"
FT                   /product="TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41192"
FT                   /db_xref="GOA:C4KEJ5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEJ5"
FT                   /protein_id="ACR41192.1"
FT                   /translation="MSLQRDLFGNYNSWFIKNKIIPITSNVKKEDNIECLNLGPPQSGK
FT                   SWIAGLIQQHCTPVKESIIGLINLEPVEPKKEHRITAVQQPLIQGNKLLDTIVNFFSQH
FT                   IFPWINTLRETEAIDFNKLTNFSEHELDLLKEYFSEVKRVPRGLTKHLIELREKYGPII
FT                   IYYIPWDVNKYVESGEIGLDEQVIEAVRLIKKYFNKEKKHLPIKWLGKDYIPPGLVYEI
FT                   INKASEVGCAKVEGCKVAEEFVKEQADAYYEVVKFLVGEKDSEFEGILGLSITKLKNSI
FT                   HDILSNVISTVIIGVMSLTVSIVILTLISASMYMLSERSEHGIADEIIKLKTNWGKLSE
FT                   PLKKIIEWKVSIQLGVTPGDVERAINHMTGLDEQKIRESVKELEKKLEELESRVYLVES
FT                   QLKGFKIYKLSDIEKGYLYSNVRLVNDSLGIVSETYGKTEVNIVKVNKFNEYLTLLARE
FT                   LEKGFTVINGPKGIGKSTLAVYTIWNLLRDGYYGVIRVEDIIDDNKRLKLENFLRDYSD
FT                   DLYSDNLKAYLGKLIILYDPSSTESFTSPIVSINVKSVEETVKQLVKLSNELDKYGTSL
FT                   LIVIPDDLYNGLSEEVRKSLKNVINIDLKDAEFLKAVIKEYSGCNLGDKLNELSNEVMQ
FT                   FSEGYTLIARLIGEGLRKSNCSLIEIEKILRDAQGNAKAFIMNFINNYLRIVYNGTPNV
FT                   QRIKTFSEILSVMEPFKLISKVGDYIATPYFIGRLAYWSSELGLSDEERNWLAIKHEDL
FT                   IEAAITEIVKAVNGGQTASELNEALRYWREYGELKIFGNVDDLENRTWDTIDYLFGKYG
FT                   ERLKKAFENVDDKCWKGLILTLGTAWSQSLGVLESAKKLNDLAEDVREAVEYLDGDYCD
FT                   ALNLLIANWKLAWISDYLLIRLKVESLEAGGSGEKKLVNPILHSLAEGKSSQVKESLKR
FT                   LSETAIGRKGIWSVESFYGLGLSILSAYANMEGIGGYDDEKLAINALKLAGWSIEAISN
FT                   PPLVHLVTTLCGYLGIHNLNYWSLVLFRATDVLSNNEELKKLKPFVDDLWKIRDGLEDW
FT                   SRALLVHTMANTLSVSGDVCNTFRNIVDLMNEIGSIPLTKIAFADVYQGYVDLGLNCKN
FT                   VPHSVNLCGCKVSLLDPLQGLNNLIGCFGNTDSWLNDDQLVEYLRGRSFEDDKDALNWV
FT                   INGTLGSIYFSLGKINLYEGDFDKAEDYYKKAKEIDEKLENWVNYIALYNLIARVRGIK
FT                   AKDFNKLLEVTKEFEDVFKEAYEKLGVGTAGLTLRTDILSEYLVYLGLSGNKEGAKKVL
FT                   EEHGWLLVFLPSNVRTLTRLLLYRLGIVNDKPSVGKILDSITFRPWSVFLKPAFKISLG
FT                   MEVDCFEECSSLEGCDEDCLTDCDDFCSLLKSAIKGDKGDLKKFVNRLRAVIGDEIVNK
FT                   LATGEYSVEAVVQAITPSESMDSLVLILYNLVNNDYVKAEAIAEIGELAYDEPVLKKLF
FT                   GELKDAIEKRDEEGIKFVLAKLYYFHV"
     MSLQRDLFGN YNSWFIKNKI IPITSNVKKE DNIECLNLGP PQSGKSWIAG LIQQHCTPVK        60
     ESIIGLINLE PVEPKKEHRI TAVQQPLIQG NKLLDTIVNF FSQHIFPWIN TLRETEAIDF       120
     NKLTNFSEHE LDLLKEYFSE VKRVPRGLTK HLIELREKYG PIIIYYIPWD VNKYVESGEI       180
     GLDEQVIEAV RLIKKYFNKE KKHLPIKWLG KDYIPPGLVY EIINKASEVG CAKVEGCKVA       240
     EEFVKEQADA YYEVVKFLVG EKDSEFEGIL GLSITKLKNS IHDILSNVIS TVIIGVMSLT       300
     VSIVILTLIS ASMYMLSERS EHGIADEIIK LKTNWGKLSE PLKKIIEWKV SIQLGVTPGD       360
     VERAINHMTG LDEQKIRESV KELEKKLEEL ESRVYLVESQ LKGFKIYKLS DIEKGYLYSN       420
     VRLVNDSLGI VSETYGKTEV NIVKVNKFNE YLTLLARELE KGFTVINGPK GIGKSTLAVY       480
     TIWNLLRDGY YGVIRVEDII DDNKRLKLEN FLRDYSDDLY SDNLKAYLGK LIILYDPSST       540
     ESFTSPIVSI NVKSVEETVK QLVKLSNELD KYGTSLLIVI PDDLYNGLSE EVRKSLKNVI       600
     NIDLKDAEFL KAVIKEYSGC NLGDKLNELS NEVMQFSEGY TLIARLIGEG LRKSNCSLIE       660
     IEKILRDAQG NAKAFIMNFI NNYLRIVYNG TPNVQRIKTF SEILSVMEPF KLISKVGDYI       720
     ATPYFIGRLA YWSSELGLSD EERNWLAIKH EDLIEAAITE IVKAVNGGQT ASELNEALRY       780
     WREYGELKIF GNVDDLENRT WDTIDYLFGK YGERLKKAFE NVDDKCWKGL ILTLGTAWSQ       840
     SLGVLESAKK LNDLAEDVRE AVEYLDGDYC DALNLLIANW KLAWISDYLL IRLKVESLEA       900
     GGSGEKKLVN PILHSLAEGK SSQVKESLKR LSETAIGRKG IWSVESFYGL GLSILSAYAN       960
     MEGIGGYDDE KLAINALKLA GWSIEAISNP PLVHLVTTLC GYLGIHNLNY WSLVLFRATD      1020
     VLSNNEELKK LKPFVDDLWK IRDGLEDWSR ALLVHTMANT LSVSGDVCNT FRNIVDLMNE      1080
     IGSIPLTKIA FADVYQGYVD LGLNCKNVPH SVNLCGCKVS LLDPLQGLNN LIGCFGNTDS      1140
     WLNDDQLVEY LRGRSFEDDK DALNWVINGT LGSIYFSLGK INLYEGDFDK AEDYYKKAKE      1200
     IDEKLENWVN YIALYNLIAR VRGIKAKDFN KLLEVTKEFE DVFKEAYEKL GVGTAGLTLR      1260
     TDILSEYLVY LGLSGNKEGA KKVLEEHGWL LVFLPSNVRT LTRLLLYRLG IVNDKPSVGK      1320
     ILDSITFRPW SVFLKPAFKI SLGMEVDCFE ECSSLEGCDE DCLTDCDDFC SLLKSAIKGD      1380
     KGDLKKFVNR LRAVIGDEIV NKLATGEYSV EAVVQAITPS ESMDSLVLIL YNLVNNDYVK      1440
     AEAIAEIGEL AYDEPVLKKL FGELKDAIEK RDEEGIKFVL AKLYYFHV                   1488
//

If you have problems or comments...

PBIL Back to PBIL home page