(data stored in ACNUC7421 zone)

EMBL: CP001402.PE559

CP001402.PE559       Location/Qualifiers
FT   CDS             complement(509053..509439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0571"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41195"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEJ8"
FT                   /protein_id="ACR41195.1"
FT                   /translation="MVDYFVSNIKEVKMDRVLVNGSKNAFIQWLVTKENDSNYAVRKFT
FT                   LLKDGIIPMHIHKYQETVVVTKGKCKVCVSDKVYELKEGDYIFINSNVKHAIINESDQL
FT                   EFFCIIDYPDDMSITTLNEDCNKK"
     MVDYFVSNIK EVKMDRVLVN GSKNAFIQWL VTKENDSNYA VRKFTLLKDG IIPMHIHKYQ        60
     ETVVVTKGKC KVCVSDKVYE LKEGDYIFIN SNVKHAIINE SDQLEFFCII DYPDDMSITT       120
     LNEDCNKK                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page