(data stored in ACNUC7421 zone)

EMBL: CP001402.PE56

CP001402.PE56        Location/Qualifiers
FT   CDS             complement(46315..48078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0056"
FT                   /product="BPS2 protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40692"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJH2"
FT                   /protein_id="ACR40692.1"
FT                   /translation="MKVRVFNIGGITQDYSLDLEKGVTSYEAPNAYGKTSLVRALISLL
FT                   TSSIKAEDLLNVFADSGYIEVELDNKLYYRRIKRIKNGLSEDKNLIMDDDRALLLTYFS
FT                   PENKLVTQILSGDGNVEWFISATSKINEIKAKKEELQKLLTAEINARDDLQKKYNNIRE
FT                   IQAKIRAIDEEIDKLEKERESSSNIVAKTTYTITLTRQNKINEIVNKIKVKKDELANLE
FT                   FALKKIEEEIQNKESKVSPDIKTQLQKELEEINEKLKLKTSDRSELEIELKVLERVLEE
FT                   VDESDKHHLDTCNVCGSKVDPSIWKERAEIISRELRDKTSLLDSLRNDIIGLQKRKEEI
FT                   DLRLKEFQTLENEIAKLKAKKEELINRIGSVKFQIDDLERQKRETEERFNKSESLSGAI
FT                   ATSDDSTSILKRIEELRKKREEYEYELQLLGVPSSILEELKEKEEHIEQLQKKVDELQV
FT                   EYIRRLTKAREEFNRISNQLLRKFEFDMEAEIDGNYRLIVRRKGAIIDIKKLSSSERTT
FT                   LALILVLSALRAYFKTPYFIIDESAMTFDQKRFNRLLEYLTEIADYVIVTRSSENTEIK
FT                   TLPPKQIEISS"
     MKVRVFNIGG ITQDYSLDLE KGVTSYEAPN AYGKTSLVRA LISLLTSSIK AEDLLNVFAD        60
     SGYIEVELDN KLYYRRIKRI KNGLSEDKNL IMDDDRALLL TYFSPENKLV TQILSGDGNV       120
     EWFISATSKI NEIKAKKEEL QKLLTAEINA RDDLQKKYNN IREIQAKIRA IDEEIDKLEK       180
     ERESSSNIVA KTTYTITLTR QNKINEIVNK IKVKKDELAN LEFALKKIEE EIQNKESKVS       240
     PDIKTQLQKE LEEINEKLKL KTSDRSELEI ELKVLERVLE EVDESDKHHL DTCNVCGSKV       300
     DPSIWKERAE IISRELRDKT SLLDSLRNDI IGLQKRKEEI DLRLKEFQTL ENEIAKLKAK       360
     KEELINRIGS VKFQIDDLER QKRETEERFN KSESLSGAIA TSDDSTSILK RIEELRKKRE       420
     EYEYELQLLG VPSSILEELK EKEEHIEQLQ KKVDELQVEY IRRLTKAREE FNRISNQLLR       480
     KFEFDMEAEI DGNYRLIVRR KGAIIDIKKL SSSERTTLAL ILVLSALRAY FKTPYFIIDE       540
     SAMTFDQKRF NRLLEYLTEI ADYVIVTRSS ENTEIKTLPP KQIEISS                     587
//

If you have problems or comments...

PBIL Back to PBIL home page