(data stored in ACNUC7421 zone)

EMBL: CP001402.PE561

CP001402.PE561       Location/Qualifiers
FT   CDS             complement(509837..510394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0573"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41197"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEK0"
FT                   /protein_id="ACR41197.1"
FT                   /translation="MCLLVINNVARPIISDDVILLRDDSFSKVKDYLRVLSSDRRDGEI
FT                   SKSYFYFIVDRLRRMGLLIDNAIGFKAVLPFTVNNKGINLKEGIMYITNDRHLIYFNYY
FT                   DATYQCDRCSITTFSCVPSLKKIAHELDIKIRSDIPNIAWYELLEDIQYYLLESSIFLR
FT                   VKTTEIGKSSEVIKVGEYARDL"
     MCLLVINNVA RPIISDDVIL LRDDSFSKVK DYLRVLSSDR RDGEISKSYF YFIVDRLRRM        60
     GLLIDNAIGF KAVLPFTVNN KGINLKEGIM YITNDRHLIY FNYYDATYQC DRCSITTFSC       120
     VPSLKKIAHE LDIKIRSDIP NIAWYELLED IQYYLLESSI FLRVKTTEIG KSSEVIKVGE       180
     YARDL                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page