(data stored in ACNUC7421 zone)

EMBL: CP001402.PE562

CP001402.PE562       Location/Qualifiers
FT   CDS             complement(510816..511502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0574"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41198"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEK1"
FT                   /protein_id="ACR41198.1"
FT                   /translation="MVKIGKVRIMELLEPEFFDTILNHNISVIENGPCGGLMIVDTGLP
FT                   GYLDQIESYLKTWGYSLEDISDIVITHWHHDHAGNAMTIKRISDAKIYAHVDELENLEN
FT                   PPKYNIIYSDELGVSFSIFKKTMERINNLHYESVKVDVALKGGEELGGFKVIHVPGHTK
FT                   GHIALFDGKYLIVGDAIRNVRNTLSPPLRIFSWNYDFAVNSFNYLVSLPYTVLIPYHGD
FT                   ITIKNL"
     MVKIGKVRIM ELLEPEFFDT ILNHNISVIE NGPCGGLMIV DTGLPGYLDQ IESYLKTWGY        60
     SLEDISDIVI THWHHDHAGN AMTIKRISDA KIYAHVDELE NLENPPKYNI IYSDELGVSF       120
     SIFKKTMERI NNLHYESVKV DVALKGGEEL GGFKVIHVPG HTKGHIALFD GKYLIVGDAI       180
     RNVRNTLSPP LRIFSWNYDF AVNSFNYLVS LPYTVLIPYH GDITIKNL                    228
//

If you have problems or comments...

PBIL Back to PBIL home page