(data stored in ACNUC7421 zone)

EMBL: CP001402.PE563

CP001402.PE563       Location/Qualifiers
FT   CDS             complement(511502..512686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0575"
FT                   /product="Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41199"
FT                   /db_xref="GOA:C4KEK2"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEK2"
FT                   /protein_id="ACR41199.1"
FT                   /translation="MALSKFNLFIGDVLFNTLTGYAVKLNLWEIEKLRKGIVPEHLKDI
FT                   IEEGFSAADEDLEEEIDKFLRKPVLEPTLVLTYNCNFDCIYCFQKGFRKNVSVSDKVIR
FT                   GFVNYIRKNERGRKVRITYFGGEPLLQLRKIEEISRELSDLKYSFSVVTNGSLLTRKIA
FT                   ERLIPLGLTYAQITLDGPKEVHDKRRFFIRGKGSFDVIVKNLKEVQDLIKVVLRINIDV
FT                   KNLTEIEELLDELKREGINKVRLDPHLVHSNTFRNEWWDFTISSKAEGDVLVKFWETAR
FT                   KYGFEVPHDVFRLGFCVAYSNEDIVVDPEGNIYPCWAFTGNPLYVKGKLEEDGSVKVTN
FT                   KSLWWKVKIEDKCKSCPYLPLCMGGCKFLSSINGDDCKREAYEKVVRLIRLVMD"
     MALSKFNLFI GDVLFNTLTG YAVKLNLWEI EKLRKGIVPE HLKDIIEEGF SAADEDLEEE        60
     IDKFLRKPVL EPTLVLTYNC NFDCIYCFQK GFRKNVSVSD KVIRGFVNYI RKNERGRKVR       120
     ITYFGGEPLL QLRKIEEISR ELSDLKYSFS VVTNGSLLTR KIAERLIPLG LTYAQITLDG       180
     PKEVHDKRRF FIRGKGSFDV IVKNLKEVQD LIKVVLRINI DVKNLTEIEE LLDELKREGI       240
     NKVRLDPHLV HSNTFRNEWW DFTISSKAEG DVLVKFWETA RKYGFEVPHD VFRLGFCVAY       300
     SNEDIVVDPE GNIYPCWAFT GNPLYVKGKL EEDGSVKVTN KSLWWKVKIE DKCKSCPYLP       360
     LCMGGCKFLS SINGDDCKRE AYEKVVRLIR LVMD                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page