(data stored in ACNUC7421 zone)

EMBL: CP001402.PE564

CP001402.PE564       Location/Qualifiers
FT   CDS             513495..513809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0577"
FT                   /product="conserved hypothetical insertion element protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41200"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEK3"
FT                   /protein_id="ACR41200.1"
FT                   /translation="MYTKLGVYLVYSVGDRNESTFREVKKYLLDEGRWVSDDYNLYFWL
FT                   KGYTVVSPVNPNESLYSSSRDRLVRFKRATKAVNRSINLMKYSIALVLWEKRLIPEFVA
FT                   "
     MYTKLGVYLV YSVGDRNEST FREVKKYLLD EGRWVSDDYN LYFWLKGYTV VSPVNPNESL        60
     YSSSRDRLVR FKRATKAVNR SINLMKYSIA LVLWEKRLIP EFVA                        104
//

If you have problems or comments...

PBIL Back to PBIL home page