(data stored in ACNUC7421 zone)

EMBL: CP001402.PE566

CP001402.PE566       Location/Qualifiers
FT   CDS             516899..517597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0580"
FT                   /product="protein of unknown function DUF124"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41202"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEK5"
FT                   /protein_id="ACR41202.1"
FT                   /translation="MPQYEILGKDLQYLKVMLGEGEAIYADAGHMVAKQSSVIMKTTMR
FT                   GGFFGALKREITGGSFFVTEFLGPGEVYLSGVFPGPIVQIQLQGNGILAESHSFLCAEN
FT                   NVNYDATLNRLGVGWLGGEGIFLARFRGDGNVFLHAYGGLIEKYLNPGESLQVEASHLM
FT                   AFEEGMRYGIQPVGGIRSLLFSGEGLFFVNIEGPGKIWLHTLTVEQLVASLRPYLPQGQ
FT                   QGGPGFNIRI"
     MPQYEILGKD LQYLKVMLGE GEAIYADAGH MVAKQSSVIM KTTMRGGFFG ALKREITGGS        60
     FFVTEFLGPG EVYLSGVFPG PIVQIQLQGN GILAESHSFL CAENNVNYDA TLNRLGVGWL       120
     GGEGIFLARF RGDGNVFLHA YGGLIEKYLN PGESLQVEAS HLMAFEEGMR YGIQPVGGIR       180
     SLLFSGEGLF FVNIEGPGKI WLHTLTVEQL VASLRPYLPQ GQQGGPGFNI RI               232
//

If you have problems or comments...

PBIL Back to PBIL home page