(data stored in ACNUC7421 zone)

EMBL: CP001402.PE567

CP001402.PE567       Location/Qualifiers
FT   CDS             complement(517934..518632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41203"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEK6"
FT                   /protein_id="ACR41203.1"
FT                   /translation="MWKVPVLIQLLLILMEYINLKPRFYSKGTLAYALADYISGLSSWR
FT                   AVLPHSTLLYYHRRLSYVKYAVPLSGVYAIDETKVRLVKDKYYYVWIVRDVKTKPIPFF
FT                   MLTGVRSGVHILVVLVNMSRVEEITRRVFRTRVDKVVYLHDGATAYNAFSWFNVEHNKV
FT                   TFNEREYAEQGFRSLKHKLASMDFHFPWNSNKLTITRWLSTFFLMFNTLCTPTCLLDKE
FT                   VIINVNISNE"
     MWKVPVLIQL LLILMEYINL KPRFYSKGTL AYALADYISG LSSWRAVLPH STLLYYHRRL        60
     SYVKYAVPLS GVYAIDETKV RLVKDKYYYV WIVRDVKTKP IPFFMLTGVR SGVHILVVLV       120
     NMSRVEEITR RVFRTRVDKV VYLHDGATAY NAFSWFNVEH NKVTFNEREY AEQGFRSLKH       180
     KLASMDFHFP WNSNKLTITR WLSTFFLMFN TLCTPTCLLD KEVIINVNIS NE               232
//

If you have problems or comments...

PBIL Back to PBIL home page