(data stored in ACNUC7421 zone)

EMBL: CP001402.PE574

CP001402.PE574       Location/Qualifiers
FT   CDS             528981..530063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0589"
FT                   /product="protein of unknown function DUF917"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41210"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="InterPro:IPR027479"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEL3"
FT                   /protein_id="ACR41210.1"
FT                   /translation="METYFIQERDLQNLVTGASFLGTGGGGDPYIGGLMLKRELELVKK
FT                   IEVITGVKYSNSKSFVLGSAMMGAPIVMIEKIPSSSEAKKALEVYSKFSGNEVEYITPL
FT                   EMGGVNSTIPLITSAKTGIPVIDGDGMGRAFPELQMTTFYFYGVQPSPIVIFDERGNVS
FT                   IVQGIDGYWSEKIARVITVRYGGSAYIALYGTSLSTYSNTAVLGTLSLALEIGELLNQM
FT                   RLDDVLDLLKAMIVFKGKVVDVQRRVEKGFSKGNVIIDGIENIGEQTMKIDFQNEFLVA
FT                   RINNNIVTTVPDLITVLDLFTLKPITTDRIKYGQKVMVIGIPSSARLRSKEALRYIGPR
FT                   AFGYDVDFIPLEERWKKVEN"
     METYFIQERD LQNLVTGASF LGTGGGGDPY IGGLMLKREL ELVKKIEVIT GVKYSNSKSF        60
     VLGSAMMGAP IVMIEKIPSS SEAKKALEVY SKFSGNEVEY ITPLEMGGVN STIPLITSAK       120
     TGIPVIDGDG MGRAFPELQM TTFYFYGVQP SPIVIFDERG NVSIVQGIDG YWSEKIARVI       180
     TVRYGGSAYI ALYGTSLSTY SNTAVLGTLS LALEIGELLN QMRLDDVLDL LKAMIVFKGK       240
     VVDVQRRVEK GFSKGNVIID GIENIGEQTM KIDFQNEFLV ARINNNIVTT VPDLITVLDL       300
     FTLKPITTDR IKYGQKVMVI GIPSSARLRS KEALRYIGPR AFGYDVDFIP LEERWKKVEN       360
//

If you have problems or comments...

PBIL Back to PBIL home page