(data stored in ACNUC7421 zone)

EMBL: CP001402.PE577

CP001402.PE577       Location/Qualifiers
FT   CDS             533146..533490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0592"
FT                   /product="conserved hypothetical insertion element protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41213"
FT                   /db_xref="GOA:C4KEL6"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEL6"
FT                   /protein_id="ACR41213.1"
FT                   /translation="MSVIEIKDIDSGLKEDRRGLKKLLDLAKRRQIDAVVVAYKDKLTR
FT                   FGFEYLVELFKAYGVNVVIAFQEEPKDYMQELVEDFVEIVKSFASRIYGHRSHKYEKVV
FT                   KCVEDVEKDS"
     MSVIEIKDID SGLKEDRRGL KKLLDLAKRR QIDAVVVAYK DKLTRFGFEY LVELFKAYGV        60
     NVVIAFQEEP KDYMQELVED FVEIVKSFAS RIYGHRSHKY EKVVKCVEDV EKDS             114
//

If you have problems or comments...

PBIL Back to PBIL home page