(data stored in ACNUC7421 zone)

EMBL: CP001402.PE579

CP001402.PE579       Location/Qualifiers
FT   CDS             535128..535832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0594"
FT                   /product="Bacterio-opsin activator HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41215"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEL8"
FT                   /protein_id="ACR41215.1"
FT                   /translation="MSLFNLSLVIFEIDHEDCWSKLTSSYPVLVKTIFAKPNKGKDYIL
FT                   GMDEVKTYTRRTFKDFLKSFKRDKSIYEIIQILELDNRRGIYRILFKERYENMIMSIIG
FT                   NYMTFYVKDLIKEGNERLLLIMPSSDVTMLKRDLESIGKIHYFNSKLVNFNDFVPTFFD
FT                   LSEQERNAVLQAIRLGYYEYPRRINLEELGKIMGISKPTLEEYLRKAEKKIMSKIFREF
FT                   YQQDLLFHSPDY"
     MSLFNLSLVI FEIDHEDCWS KLTSSYPVLV KTIFAKPNKG KDYILGMDEV KTYTRRTFKD        60
     FLKSFKRDKS IYEIIQILEL DNRRGIYRIL FKERYENMIM SIIGNYMTFY VKDLIKEGNE       120
     RLLLIMPSSD VTMLKRDLES IGKIHYFNSK LVNFNDFVPT FFDLSEQERN AVLQAIRLGY       180
     YEYPRRINLE ELGKIMGISK PTLEEYLRKA EKKIMSKIFR EFYQQDLLFH SPDY             234
//

If you have problems or comments...

PBIL Back to PBIL home page