(data stored in ACNUC7421 zone)

EMBL: CP001402.PE585

CP001402.PE585       Location/Qualifiers
FT   CDS             complement(542173..542583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0601"
FT                   /product="transposase IS200-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41221"
FT                   /db_xref="GOA:C4KEM4"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEM4"
FT                   /protein_id="ACR41221.1"
FT                   /translation="MEYKSTRHAKYLCNYHFVWIPKYRRDLLIDEVAEYTKEVLKSIAE
FT                   ELGCEIITLEVMPDHIHLFVNCPPRYSPSYLANYFKGKSARLVLKKFPELRKHTGGKLW
FT                   TRNYFISTAGNVSSETIKKYIEEQWEKEDEEN"
     MEYKSTRHAK YLCNYHFVWI PKYRRDLLID EVAEYTKEVL KSIAEELGCE IITLEVMPDH        60
     IHLFVNCPPR YSPSYLANYF KGKSARLVLK KFPELRKHTG GKLWTRNYFI STAGNVSSET       120
     IKKYIEEQWE KEDEEN                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page