(data stored in ACNUC7421 zone)

EMBL: CP001402.PE586

CP001402.PE586       Location/Qualifiers
FT   CDS             complement(542753..543676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0603"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41222"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEM5"
FT                   /protein_id="ACR41222.1"
FT                   /translation="MSSEERNLENVIDELRKKLDDAENEASKYGTIIGRVTRYESVSVN
FT                   ENELVGVDVLFDNYQNSDIKRGQYLAIRSIIKPIIMLGQVYSISRADALSRLGIRELTY
FT                   PRDPSTIITTTYIALRPIAEMEGDKIRPAVSPIDPQSPVFIPNPNLIERILRIPEKGIV
FT                   IGKIFSGGEEIEAEVKLDQYALRHHTLILGTTGSGKTTLLKTIISSQDIDKSTLIFDRQ
FT                   GDFVNFLKDRKDFSVLMPVVEEPNSKVSIQDHVEDFANWYGCDPNTINVVNGYGAFVRC
FT                   NNHDVFVVPYSINFYDNLRNFNKITP"
     MSSEERNLEN VIDELRKKLD DAENEASKYG TIIGRVTRYE SVSVNENELV GVDVLFDNYQ        60
     NSDIKRGQYL AIRSIIKPII MLGQVYSISR ADALSRLGIR ELTYPRDPST IITTTYIALR       120
     PIAEMEGDKI RPAVSPIDPQ SPVFIPNPNL IERILRIPEK GIVIGKIFSG GEEIEAEVKL       180
     DQYALRHHTL ILGTTGSGKT TLLKTIISSQ DIDKSTLIFD RQGDFVNFLK DRKDFSVLMP       240
     VVEEPNSKVS IQDHVEDFAN WYGCDPNTIN VVNGYGAFVR CNNHDVFVVP YSINFYDNLR       300
     NFNKITP                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page