(data stored in ACNUC7421 zone)

EMBL: CP001402.PE587

CP001402.PE587       Location/Qualifiers
FT   CDS             complement(543729..544130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0604"
FT                   /product="conserved conjugative plasmid protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41223"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEM6"
FT                   /protein_id="ACR41223.1"
FT                   /translation="MEESEMYLLALLKVSREDEAKLTLNEIQFIIFLLEKVLGVELNLD
FT                   FTPSIFGPYSLKLKETLKRLVSQGTVEVIKSVSLSIFDIYVLRNNVEVEIEDNVMNFFM
FT                   YWIRKDYYEIFKYLLVSYGSYFDTSATRR"
     MEESEMYLLA LLKVSREDEA KLTLNEIQFI IFLLEKVLGV ELNLDFTPSI FGPYSLKLKE        60
     TLKRLVSQGT VEVIKSVSLS IFDIYVLRNN VEVEIEDNVM NFFMYWIRKD YYEIFKYLLV       120
     SYGSYFDTSA TRR                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page