(data stored in ACNUC7421 zone)

EMBL: CP001402.PE59

CP001402.PE59        Location/Qualifiers
FT   CDS             49697..50182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0059"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40695"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJH5"
FT                   /protein_id="ACR40695.1"
FT                   /translation="MQNFREISIDIVLSHRIRNYDQIILEGSRKRDSCAFFIYGYCKKI
FT                   SSKSKVLASWISNGKIVPHPLFCYLCPFYSLRDDDKTVTIDLFDIYLTYKNLKTQIERE
FT                   LEFIESRLSEFSFSTSIALRRRREDLIAFLDDISTKIKILMEIIRVSEREHEDGRYI"
     MQNFREISID IVLSHRIRNY DQIILEGSRK RDSCAFFIYG YCKKISSKSK VLASWISNGK        60
     IVPHPLFCYL CPFYSLRDDD KTVTIDLFDI YLTYKNLKTQ IERELEFIES RLSEFSFSTS       120
     IALRRRREDL IAFLDDISTK IKILMEIIRV SEREHEDGRY I                           161
//

If you have problems or comments...

PBIL Back to PBIL home page