(data stored in ACNUC7421 zone)

EMBL: CP001402.PE592

CP001402.PE592       Location/Qualifiers
FT   CDS             complement(549270..549683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0609"
FT                   /product="PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41228"
FT                   /db_xref="InterPro:IPR001024"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEN1"
FT                   /protein_id="ACR41228.1"
FT                   /translation="MIELRLVMDSYAWIEFFLGSDKGKKVFEILSSVDEILTPDLVLAE
FT                   IGRKYIREGIDEKTIIKRLKFIEENSVILCINSELSVEGAMAYIELLNKAKNKGKSKPS
FT                   LTDSVLLAISRKYTAKIVTGDEIFKGTNEAIFI"
     MIELRLVMDS YAWIEFFLGS DKGKKVFEIL SSVDEILTPD LVLAEIGRKY IREGIDEKTI        60
     IKRLKFIEEN SVILCINSEL SVEGAMAYIE LLNKAKNKGK SKPSLTDSVL LAISRKYTAK       120
     IVTGDEIFKG TNEAIFI                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page