(data stored in ACNUC7421 zone)

EMBL: CP001402.PE595

CP001402.PE595       Location/Qualifiers
FT   CDS             complement(551031..551804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0612"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41231"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEN4"
FT                   /protein_id="ACR41231.1"
FT                   /translation="MIKLFKVFKVGDHGEVPGAEVYWMRDFDKWYRLYFYSFLLESDDG
FT                   YVLINTGLPDDLSLRNEFLRNWAKSDRCKFTVREEEKIENILRRLNLNTDDISHIIITP
FT                   FQDYTIGRLHLFKRAFIYFSKTGWYHDVVNPSPSPFLNRDIYFPKHIRNYIFEEAWNRI
FT                   RLVEDEEVIKGVEIKWSGCHHRSSMVVKFFYNGKRVCISDSAFLMGNFEQNIPIGIAED
FT                   IYECLRTYDYMRRECNIVIPAYDPENLDRFKEFTK"
     MIKLFKVFKV GDHGEVPGAE VYWMRDFDKW YRLYFYSFLL ESDDGYVLIN TGLPDDLSLR        60
     NEFLRNWAKS DRCKFTVREE EKIENILRRL NLNTDDISHI IITPFQDYTI GRLHLFKRAF       120
     IYFSKTGWYH DVVNPSPSPF LNRDIYFPKH IRNYIFEEAW NRIRLVEDEE VIKGVEIKWS       180
     GCHHRSSMVV KFFYNGKRVC ISDSAFLMGN FEQNIPIGIA EDIYECLRTY DYMRRECNIV       240
     IPAYDPENLD RFKEFTK                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page