(data stored in ACNUC7421 zone)

EMBL: CP001402.PE597

CP001402.PE597       Location/Qualifiers
FT   CDS             complement(553114..553521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0614"
FT                   /product="transposase IS200-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41233"
FT                   /db_xref="GOA:C4KEN6"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEN6"
FT                   /protein_id="ACR41233.1"
FT                   /translation="MRYRLDRESHSVYALYYHYVQVVKYRRKVFDNEDIINFLKEKIQE
FT                   ISKTFEVEVIDIGVDKDHFHMLFKAKPTLNIPKYINTIKTITSREIQRRFPQVKEKLWK
FT                   GHFWSPSYFLATSGQVTLEVLKKYVESQGKE"
     MRYRLDRESH SVYALYYHYV QVVKYRRKVF DNEDIINFLK EKIQEISKTF EVEVIDIGVD        60
     KDHFHMLFKA KPTLNIPKYI NTIKTITSRE IQRRFPQVKE KLWKGHFWSP SYFLATSGQV       120
     TLEVLKKYVE SQGKE                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page