(data stored in ACNUC7421 zone)

EMBL: CP001402.PE598

CP001402.PE598       Location/Qualifiers
FT   CDS             complement(553670..554026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0615"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41234"
FT                   /db_xref="GOA:C4KEN7"
FT                   /db_xref="InterPro:IPR001995"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEN7"
FT                   /protein_id="ACR41234.1"
FT                   /translation="MGLIYIDGIVKNERGESEKVRFLIDSGAYYTVLKKEVWQKLGLKE
FT                   ISHVSLILADGTTIERGVSEAIIELPPYGERHSPIILGESEDENLLGVVTLEIFGLVLD
FT                   PLKREIRQGRIIMK"
     MGLIYIDGIV KNERGESEKV RFLIDSGAYY TVLKKEVWQK LGLKEISHVS LILADGTTIE        60
     RGVSEAIIEL PPYGERHSPI ILGESEDENL LGVVTLEIFG LVLDPLKREI RQGRIIMK         118
//

If you have problems or comments...

PBIL Back to PBIL home page