(data stored in ACNUC7421 zone)

EMBL: CP001402.PE6

CP001402.PE6         Location/Qualifiers
FT   CDS             complement(3648..4226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0006"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40642"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJC2"
FT                   /protein_id="ACR40642.1"
FT                   /translation="MSSTKRSFTALFASRDRAEKEEKMSEKITPIFSLGNFVMDKLGNV
FT                   TQYTFFYYYDPENYYASLTREMLDKEIEVVKGNMQSFLDVEKIIINDRSTRAKVVSTDI
FT                   FLLDITHPVIEFIITFRGKLRKGLNVYENFYEEEITEYPYEAIWRFPGKILNVKMKGQI
FT                   SILENFLKIKVNKGVKVGGRERIEFFLTS"
     MSSTKRSFTA LFASRDRAEK EEKMSEKITP IFSLGNFVMD KLGNVTQYTF FYYYDPENYY        60
     ASLTREMLDK EIEVVKGNMQ SFLDVEKIII NDRSTRAKVV STDIFLLDIT HPVIEFIITF       120
     RGKLRKGLNV YENFYEEEIT EYPYEAIWRF PGKILNVKMK GQISILENFL KIKVNKGVKV       180
     GGRERIEFFL TS                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page