(data stored in ACNUC7421 zone)

EMBL: CP001402.PE600

CP001402.PE600       Location/Qualifiers
FT   CDS             complement(555634..555924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0617"
FT                   /product="conserved hypothetical PepK protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41236"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEN9"
FT                   /protein_id="ACR41236.1"
FT                   /translation="MDCEKLEKKVDGVLSILKELKGKERTTQDLDRVYDFVKDNLCMAS
FT                   IKDIREQLGMTLEEFMAKFRDYIIRNYELISGGKEGIVKEGVLYGIIRRKR"
     MDCEKLEKKV DGVLSILKEL KGKERTTQDL DRVYDFVKDN LCMASIKDIR EQLGMTLEEF        60
     MAKFRDYIIR NYELISGGKE GIVKEGVLYG IIRRKR                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page