(data stored in ACNUC7421 zone)

EMBL: CP001402.PE603

CP001402.PE603       Location/Qualifiers
FT   CDS             complement(556667..557020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41239"
FT                   /db_xref="GOA:C4KEP2"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEP2"
FT                   /protein_id="ACR41239.1"
FT                   /translation="MELIDRIKLLMRNKELRLIYTVYPIPVTEIELSVITPLIFQSDLA
FT                   NRNIFIASIIISLLSYVPLIRQSISFIVHHIKRIREARISFMLSFFIISAFESFLFMNR
FT                   ITLLSAILILTCI"
     MELIDRIKLL MRNKELRLIY TVYPIPVTEI ELSVITPLIF QSDLANRNIF IASIIISLLS        60
     YVPLIRQSIS FIVHHIKRIR EARISFMLSF FIISAFESFL FMNRITLLSA ILILTCI          117
//

If you have problems or comments...

PBIL Back to PBIL home page