(data stored in ACNUC7421 zone)

EMBL: CP001402.PE604

CP001402.PE604       Location/Qualifiers
FT   CDS             557633..557887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0621"
FT                   /product="Protein of unknown function DUF217"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41240"
FT                   /db_xref="InterPro:IPR003847"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEP3"
FT                   /protein_id="ACR41240.1"
FT                   /translation="MYIGYMKTIMIRDEVYRKLVEIKGDKSFSDLIEELIEESLSLRRK
FT                   KLEKYFGILSEEEAEELEREIKEMRKRSDESINRKLSNY"
     MYIGYMKTIM IRDEVYRKLV EIKGDKSFSD LIEELIEESL SLRRKKLEKY FGILSEEEAE        60
     ELEREIKEMR KRSDESINRK LSNY                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page