(data stored in ACNUC7421 zone)

EMBL: CP001402.PE605

CP001402.PE605       Location/Qualifiers
FT   CDS             557853..558227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0622"
FT                   /product="PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41241"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEP4"
FT                   /protein_id="ACR41241.1"
FT                   /translation="MKVLIESSAIIDYLKGNEKVKEVILNSEDFYVSSLTIYEVLLGKV
FT                   EESKILDFLSAFKVINPTKKDAIIGSRIYKKLRDRGKLIGSFDILISAQAMNKGLTLVT
FT                   KDFDFLKVKEEFDELNLILI"
     MKVLIESSAI IDYLKGNEKV KEVILNSEDF YVSSLTIYEV LLGKVEESKI LDFLSAFKVI        60
     NPTKKDAIIG SRIYKKLRDR GKLIGSFDIL ISAQAMNKGL TLVTKDFDFL KVKEEFDELN       120
     LILI                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page