(data stored in ACNUC7421 zone)

EMBL: CP001402.PE606

CP001402.PE606       Location/Qualifiers
FT   CDS             complement(558441..558728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41242"
FT                   /db_xref="GOA:C4KEP5"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEP5"
FT                   /protein_id="ACR41242.1"
FT                   /translation="MGLKPVGELGLLQFGPEVGLEARIKHKGSSERPHGMNHREIVLLS
FT                   KYMSFEEALASATSVAGECLGINADKLKEGFIADIAVFGEVTTAEDLKPV"
     MGLKPVGELG LLQFGPEVGL EARIKHKGSS ERPHGMNHRE IVLLSKYMSF EEALASATSV        60
     AGECLGINAD KLKEGFIADI AVFGEVTTAE DLKPV                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page