(data stored in ACNUC7421 zone)

EMBL: CP001402.PE607

CP001402.PE607       Location/Qualifiers
FT   CDS             complement(558828..559013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0624"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41243"
FT                   /db_xref="GOA:C4KEP6"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEP6"
FT                   /protein_id="ACR41243.1"
FT                   /translation="MINFFGTITGVIVGALVGHIIDSAITKLIYSKKYPCIKPRPFEDI
FT                   VNYINIERLEEIVNER"
     MINFFGTITG VIVGALVGHI IDSAITKLIY SKKYPCIKPR PFEDIVNYIN IERLEEIVNE        60
     R                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page