(data stored in ACNUC7421 zone)

EMBL: CP001402.PE608

CP001402.PE608       Location/Qualifiers
FT   CDS             complement(559579..560106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0625"
FT                   /product="PaREP1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41244"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEP7"
FT                   /protein_id="ACR41244.1"
FT                   /translation="MEGYLDYKNNSKGYIYAKLYDSLVEGKLALEMLQKGLLQNASSKA
FT                   FLSVKSAISALVVKNLNEIIKLKNEKEKYWYENVGYSAPTTGLIGISKDLKNLSIDAEN
FT                   AIRIALSLHKFSYNGFDPNFVDYRNSEEVISDIKEVIEWLLNLKYYFSDFWDEKLEKAK
FT                   KELEELLKNTFN"
     MEGYLDYKNN SKGYIYAKLY DSLVEGKLAL EMLQKGLLQN ASSKAFLSVK SAISALVVKN        60
     LNEIIKLKNE KEKYWYENVG YSAPTTGLIG ISKDLKNLSI DAENAIRIAL SLHKFSYNGF       120
     DPNFVDYRNS EEVISDIKEV IEWLLNLKYY FSDFWDEKLE KAKKELEELL KNTFN            175
//

If you have problems or comments...

PBIL Back to PBIL home page