(data stored in ACNUC7421 zone)

EMBL: CP001402.PE609

CP001402.PE609       Location/Qualifiers
FT   CDS             complement(560307..560912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41245"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEP8"
FT                   /protein_id="ACR41245.1"
FT                   /translation="MAISCDRIFVEGATEKIILSKLGFNEDNIEVKFGKEEVIKEFKKY
FT                   LSSSMSILKKGNVCFVIDGDEEGYKGVYDRLKKDISVLDYSPPYIKMCKDNLCYVLVVI
FT                   GNKNDDFKGCIETILLEKLKIDEKINDVIHRVLEYEQQKVGHLSMCDRDKIRFYLSIFL
FT                   LSGEPTLLYLSKRFTEELFRIVGEDVIRNIIADFIEIK"
     MAISCDRIFV EGATEKIILS KLGFNEDNIE VKFGKEEVIK EFKKYLSSSM SILKKGNVCF        60
     VIDGDEEGYK GVYDRLKKDI SVLDYSPPYI KMCKDNLCYV LVVIGNKNDD FKGCIETILL       120
     EKLKIDEKIN DVIHRVLEYE QQKVGHLSMC DRDKIRFYLS IFLLSGEPTL LYLSKRFTEE       180
     LFRIVGEDVI RNIIADFIEI K                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page