(data stored in ACNUC7421 zone)

EMBL: CP001402.PE610

CP001402.PE610       Location/Qualifiers
FT   CDS             complement(560918..561817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0627"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41246"
FT                   /db_xref="GOA:C4KEP9"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEP9"
FT                   /protein_id="ACR41246.1"
FT                   /translation="MNISEVNVEGFRGLKIATRLKRINIVVGENGSGKTSFLESIFMST
FT                   LFQSDINDNDIYTFLIYILNSRGDILSAFSTLSDSKVRLDGVITQFKKIDPYSIDVEIN
FT                   NEKVVEIRVKSGILTTETLSGPLFLPIVRIIKRVNIKYSPLYISTFFDSSGNPERIYSI
FT                   AKRKNRKIESNFEILQDEYGQFKLYYDRLPAYVMGRGLLKRELIKLALMSSDILLIDEI
FT                   EDSLHPDLVMEVLNDIKNEKGVQVIFTTHVNEVVKMAGKVLDDSEAQVIYLSKVGYKTY
FT                   KLSEISEFEKPLSWLGYV"
     MNISEVNVEG FRGLKIATRL KRINIVVGEN GSGKTSFLES IFMSTLFQSD INDNDIYTFL        60
     IYILNSRGDI LSAFSTLSDS KVRLDGVITQ FKKIDPYSID VEINNEKVVE IRVKSGILTT       120
     ETLSGPLFLP IVRIIKRVNI KYSPLYISTF FDSSGNPERI YSIAKRKNRK IESNFEILQD       180
     EYGQFKLYYD RLPAYVMGRG LLKRELIKLA LMSSDILLID EIEDSLHPDL VMEVLNDIKN       240
     EKGVQVIFTT HVNEVVKMAG KVLDDSEAQV IYLSKVGYKT YKLSEISEFE KPLSWLGYV        299
//

If you have problems or comments...

PBIL Back to PBIL home page