(data stored in ACNUC7421 zone)

EMBL: CP001402.PE611

CP001402.PE611       Location/Qualifiers
FT   CDS             562396..562854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0628"
FT                   /product="conserved conjugative plasmid protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41247"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEQ0"
FT                   /protein_id="ACR41247.1"
FT                   /translation="MNMLIMSVNNNSKYILGILKIAKELNIQVTATRIQKTVFLVEKEL
FT                   KLDLGYNFIPFYFGPFSKELQDDIYKLSELGYVKIREEPVEDLISGVIVGFKKIYEINV
FT                   TFDLSSLDKNFVDFVTEKLKMPLNSLLKYVYMKYPEYTVNSLIKDKIF"
     MNMLIMSVNN NSKYILGILK IAKELNIQVT ATRIQKTVFL VEKELKLDLG YNFIPFYFGP        60
     FSKELQDDIY KLSELGYVKI REEPVEDLIS GVIVGFKKIY EINVTFDLSS LDKNFVDFVT       120
     EKLKMPLNSL LKYVYMKYPE YTVNSLIKDK IF                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page