(data stored in ACNUC7421 zone)

EMBL: CP001402.PE612

CP001402.PE612       Location/Qualifiers
FT   CDS             562867..563751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41248"
FT                   /db_xref="GOA:C4KEQ1"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEQ1"
FT                   /protein_id="ACR41248.1"
FT                   /translation="MSNSPFFLDYLEDGLVDWNRALDAKELIKNKYEKLLKEGLISKEE
FT                   LERYEYRKIYDLQQATEKISKGLLLIYAGIILLPFLIVAEIRNFDVRHPREMQEILNSA
FT                   EKFIRKSIDLNDIEKLGHEPVKVSNLKELLELTQHSYRRYLGITDLAKCLKSIENFITS
FT                   SLKNKKWKTLWEIVKTCEKSFNFSQFSQEVLQFLKRCISGDEEACKKLNLSDEKLSNLL
FT                   ENPYIIRFSLIMAESSIKEFLDMILLTSYLEPLSTASRYSVSIDNTRRELLEDVKENQD
FT                   NIMSFLEVKNTDY"
     MSNSPFFLDY LEDGLVDWNR ALDAKELIKN KYEKLLKEGL ISKEELERYE YRKIYDLQQA        60
     TEKISKGLLL IYAGIILLPF LIVAEIRNFD VRHPREMQEI LNSAEKFIRK SIDLNDIEKL       120
     GHEPVKVSNL KELLELTQHS YRRYLGITDL AKCLKSIENF ITSSLKNKKW KTLWEIVKTC       180
     EKSFNFSQFS QEVLQFLKRC ISGDEEACKK LNLSDEKLSN LLENPYIIRF SLIMAESSIK       240
     EFLDMILLTS YLEPLSTASR YSVSIDNTRR ELLEDVKENQ DNIMSFLEVK NTDY             294
//

If you have problems or comments...

PBIL Back to PBIL home page