(data stored in ACNUC7421 zone)

EMBL: CP001402.PE614

CP001402.PE614       Location/Qualifiers
FT   CDS             565697..566971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0631"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41250"
FT                   /db_xref="GOA:C4KEQ3"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEQ3"
FT                   /protein_id="ACR41250.1"
FT                   /translation="MSKGIKTSVRVYKIDYMSSNNKKINERDLALLKKVGKYYLQYKGI
FT                   IDLDKLLSIIEATEELNIDNITRIYIIQYIIYLAVKAAVRAAKEAEKDRLTYKEFSIGY
FT                   DQDIFGELNIDRTTIVYPQGLYAYYTYTEGYNAPEYGILGYLLRRIYDTAIDKFVEIKL
FT                   HHYFNFTEKMKKFMKKLEEIKEKFPEGYYRNSTYTDPQWLIRAFRAYEIMKKLENIGIG
FT                   LKRSKTEIKRPLIKFILWKLYELYIFYLIVNYLKKKGYRIKRKGDKNYLAFKDGIYFTI
FT                   IFNSNLENSRLLRVNNYPNLEKFKGKPDISLDHNSGDKNNIIIIECKYSDRLSYISMGR
FT                   FKIMAYVYEYNPLTAILVYPGLKEGQLLYDDEDKATKELDDYVKKNNYVKFEFKNHELY
FT                   MARINPKAEDEKNLKTIDEILGKYI"
     MSKGIKTSVR VYKIDYMSSN NKKINERDLA LLKKVGKYYL QYKGIIDLDK LLSIIEATEE        60
     LNIDNITRIY IIQYIIYLAV KAAVRAAKEA EKDRLTYKEF SIGYDQDIFG ELNIDRTTIV       120
     YPQGLYAYYT YTEGYNAPEY GILGYLLRRI YDTAIDKFVE IKLHHYFNFT EKMKKFMKKL       180
     EEIKEKFPEG YYRNSTYTDP QWLIRAFRAY EIMKKLENIG IGLKRSKTEI KRPLIKFILW       240
     KLYELYIFYL IVNYLKKKGY RIKRKGDKNY LAFKDGIYFT IIFNSNLENS RLLRVNNYPN       300
     LEKFKGKPDI SLDHNSGDKN NIIIIECKYS DRLSYISMGR FKIMAYVYEY NPLTAILVYP       360
     GLKEGQLLYD DEDKATKELD DYVKKNNYVK FEFKNHELYM ARINPKAEDE KNLKTIDEIL       420
     GKYI                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page