(data stored in ACNUC7421 zone)

EMBL: CP001402.PE62

CP001402.PE62        Location/Qualifiers
FT   CDS             complement(51911..52930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0062"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40698"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJH8"
FT                   /protein_id="ACR40698.1"
FT                   /translation="MIRKIYDKLAESHNEIKNQIYNIASYLRQEIQEKVNEFWTEYTRD
FT                   NELSEICKFVAIDGGSFSKPMRIGIVYAVGAESVIGDNKGVKTLSEDGQIGIFKPGNDA
FT                   QERISLLMEALELSLALRDGSKGDYILMDGSLNKKIGNKVDIQQISDEELKLVKNVDIN
FT                   SIISIKDERKMRDLLMLLNQFLVSRIIEQYDGKVLWISKTSRGRDLFGTDYPDITVFEL
FT                   FTEKRGFSKLIIKNIDIRKISEIPELEILRKMEYTTFYTRLDNGKRVVRIDMVGRVDEK
FT                   IVKEIMDHLSGVSIKGYPFPLLKAHIDVRFSRMDREKIIKLMGSKLHKDIEWWPSQFY"
     MIRKIYDKLA ESHNEIKNQI YNIASYLRQE IQEKVNEFWT EYTRDNELSE ICKFVAIDGG        60
     SFSKPMRIGI VYAVGAESVI GDNKGVKTLS EDGQIGIFKP GNDAQERISL LMEALELSLA       120
     LRDGSKGDYI LMDGSLNKKI GNKVDIQQIS DEELKLVKNV DINSIISIKD ERKMRDLLML       180
     LNQFLVSRII EQYDGKVLWI SKTSRGRDLF GTDYPDITVF ELFTEKRGFS KLIIKNIDIR       240
     KISEIPELEI LRKMEYTTFY TRLDNGKRVV RIDMVGRVDE KIVKEIMDHL SGVSIKGYPF       300
     PLLKAHIDVR FSRMDREKII KLMGSKLHKD IEWWPSQFY                              339
//

If you have problems or comments...

PBIL Back to PBIL home page