(data stored in ACNUC7421 zone)

EMBL: CP001402.PE621

CP001402.PE621       Location/Qualifiers
FT   CDS             complement(574996..575442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41257"
FT                   /db_xref="UniProtKB/TrEMBL:C4KER0"
FT                   /protein_id="ACR41257.1"
FT                   /translation="MKVKIIYDDGKEEEIEPKKVEVTSSNDNKNYAHYKYTKMEDSKII
FT                   IFHVYLVTNEKPSVILPKIEEEVKSKTSKIVGYKNIADDLIARARITQLQQQVQTCIYC
FT                   GEIATNQYAGKTVCSSCFNYLVKYGEDSTEFRKYLNRKLLDKWK"
     MKVKIIYDDG KEEEIEPKKV EVTSSNDNKN YAHYKYTKME DSKIIIFHVY LVTNEKPSVI        60
     LPKIEEEVKS KTSKIVGYKN IADDLIARAR ITQLQQQVQT CIYCGEIATN QYAGKTVCSS       120
     CFNYLVKYGE DSTEFRKYLN RKLLDKWK                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page