(data stored in ACNUC7421 zone)

EMBL: CP001402.PE623

CP001402.PE623       Location/Qualifiers
FT   CDS             complement(576919..578079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41259"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:C4KER2"
FT                   /protein_id="ACR41259.1"
FT                   /translation="MIDVSEGNSSVNLDRRKFLFLTSSAILFSTPATLLITAKDRKEIA
FT                   KAQTSSSSIYPYIAIVEGDPSNGYNVLTDSGVIFNGSCTDGSGTCGIYEAIQYLQNNYG
FT                   QGEVVLLGKFYPIKSPITSPPNNIEITGSGMICINPGSAPMFISLLPIISNEIKILWYT
FT                   NTGIINKILTKRRSFSLLPYVLFTGTIQSLLFANGDQALGTPSQFTISAWIFGKPSGYT
FT                   GYILSYGSLEDGEAWGIRASSNDIIFEGTTGSISAPFPSNIPFHLVVTYNNGQAAIYIN
FT                   GNQVASGSISVNYPNRAYLWINNFPIHSQQGGLNLGSWYSIIENIQFYTTVLSSSQIST
FT                   LSSSIAQDPVTIPVFWSLYRYLMYLGDLITGIGFQRMGALFYGGVT"
     MIDVSEGNSS VNLDRRKFLF LTSSAILFST PATLLITAKD RKEIAKAQTS SSSIYPYIAI        60
     VEGDPSNGYN VLTDSGVIFN GSCTDGSGTC GIYEAIQYLQ NNYGQGEVVL LGKFYPIKSP       120
     ITSPPNNIEI TGSGMICINP GSAPMFISLL PIISNEIKIL WYTNTGIINK ILTKRRSFSL       180
     LPYVLFTGTI QSLLFANGDQ ALGTPSQFTI SAWIFGKPSG YTGYILSYGS LEDGEAWGIR       240
     ASSNDIIFEG TTGSISAPFP SNIPFHLVVT YNNGQAAIYI NGNQVASGSI SVNYPNRAYL       300
     WINNFPIHSQ QGGLNLGSWY SIIENIQFYT TVLSSSQIST LSSSIAQDPV TIPVFWSLYR       360
     YLMYLGDLIT GIGFQRMGAL FYGGVT                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page