(data stored in ACNUC7421 zone)

EMBL: CP001402.PE63

CP001402.PE63        Location/Qualifiers
FT   CDS             complement(52927..55521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0063"
FT                   /product="Rad50 zinc hook domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40699"
FT                   /db_xref="GOA:C4KJH9"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR013134"
FT                   /db_xref="InterPro:IPR022982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJH9"
FT                   /protein_id="ACR40699.1"
FT                   /translation="MRIDKITLTNFLSHEHSEIHFLGEINVIVGQNGAGKSSIIDGIVF
FT                   SLFRTHSRGNNDNLIRKGSNKASVTLHLSNEKDKIEIIRDIRSTTEDRLIRNQIPVARS
FT                   ATVVSNEIEKILGIDKDIALSTIIVRQGELDKILENLQDIMGKILKLESIEKLIDSRGP
FT                   IVEFKKNLENKLRELDKIEQDYNDSKKNLEEKRNRVLELEKDRKKLEDEIKNLENQITE
FT                   LKKQFEDYEKKRNQYLELTTILKVKETKLNELNKSIEELRRQTENMDKLEKEVNELDNL
FT                   KNFRLKFEKYEVLSRSYIEISNNILNLEKEIEEYEKAIKRKKELEPHYLRYKELERKLE
FT                   ELQPKHEEYLKSKSNLDSKLNLKERLEKDASEFSKDIDRISNLEQIMEEKRKRQLDLRA
FT                   QLGKVESLISEKNEIINNLSQVKGETCPVCGRPLDEEHKQKIVEEAKSYISRLELDKNE
FT                   LEEELKKTTDELNKIEKEYRKLSNNKANYDNVIKQLRKLNEEIENLHNRIEALKDIEEE
FT                   IKKINVEIKDLKQYYEEFMRLFKYDEKELERKKNRLDEMNKKKVEIEKEMRALETELQG
FT                   LDRKELENKISDLERKKKILDEMKKKRGVLEDYIGQVELLQEDVKKLREKLNIIQFDEN
FT                   KYNELKTSLDVHNASLKEKENRKSRVEGELDSLGKDIEEISNRIKNYELQLKDKEKIIN
FT                   GINKLEKIRDALGERKLQSYIIMATKQLIENNLNDIISKFDLSIKNVEMEIMPKTSRGK
FT                   GSGGNIVIYTNNGDTLPIVSLSGGERIALSIALRLAIAKALMSNTNFFILDEPTIHLDD
FT                   QRKAYLIEIIRAAKESVPQILVVTHDEEVVQAADYVIRVEKRGNKSFVREET"
     MRIDKITLTN FLSHEHSEIH FLGEINVIVG QNGAGKSSII DGIVFSLFRT HSRGNNDNLI        60
     RKGSNKASVT LHLSNEKDKI EIIRDIRSTT EDRLIRNQIP VARSATVVSN EIEKILGIDK       120
     DIALSTIIVR QGELDKILEN LQDIMGKILK LESIEKLIDS RGPIVEFKKN LENKLRELDK       180
     IEQDYNDSKK NLEEKRNRVL ELEKDRKKLE DEIKNLENQI TELKKQFEDY EKKRNQYLEL       240
     TTILKVKETK LNELNKSIEE LRRQTENMDK LEKEVNELDN LKNFRLKFEK YEVLSRSYIE       300
     ISNNILNLEK EIEEYEKAIK RKKELEPHYL RYKELERKLE ELQPKHEEYL KSKSNLDSKL       360
     NLKERLEKDA SEFSKDIDRI SNLEQIMEEK RKRQLDLRAQ LGKVESLISE KNEIINNLSQ       420
     VKGETCPVCG RPLDEEHKQK IVEEAKSYIS RLELDKNELE EELKKTTDEL NKIEKEYRKL       480
     SNNKANYDNV IKQLRKLNEE IENLHNRIEA LKDIEEEIKK INVEIKDLKQ YYEEFMRLFK       540
     YDEKELERKK NRLDEMNKKK VEIEKEMRAL ETELQGLDRK ELENKISDLE RKKKILDEMK       600
     KKRGVLEDYI GQVELLQEDV KKLREKLNII QFDENKYNEL KTSLDVHNAS LKEKENRKSR       660
     VEGELDSLGK DIEEISNRIK NYELQLKDKE KIINGINKLE KIRDALGERK LQSYIIMATK       720
     QLIENNLNDI ISKFDLSIKN VEMEIMPKTS RGKGSGGNIV IYTNNGDTLP IVSLSGGERI       780
     ALSIALRLAI AKALMSNTNF FILDEPTIHL DDQRKAYLIE IIRAAKESVP QILVVTHDEE       840
     VVQAADYVIR VEKRGNKSFV REET                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page