(data stored in ACNUC7421 zone)

EMBL: CP001402.PE635

CP001402.PE635       Location/Qualifiers
FT   CDS             complement(591388..592890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0652"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41271"
FT                   /db_xref="GOA:C4KES4"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:C4KES4"
FT                   /protein_id="ACR41271.1"
FT                   /translation="MSDLEKLGKNLTLNYVNLLQGRFISHIIGFIGSILVIRILEPADY
FT                   GILSIAMSLPYTVSIFGNLGVNTAVTRFVAKYKEIDLTKAYSMITSGMIFDVIYGILLS
FT                   VIGYLLTPYIFTYIYNKPEIIPYGEFASFFTIPYWASSSIFSGILGLELTKHNSEMWII
FT                   HYSVQTILSVGLALSFLRVYGVIIGYIIGYTAIVIYGIVILKRKSLLGKPSINNMKELV
FT                   IFGFPLVLPSLGSSISGIYTTSLVNRFLSIFEISNLTASSKLGTLFDTILNPLSYALQP
FT                   TLSKLDRNKHDIVKVTNELYKLNIILQLPILISVEYLAYQIIYVLAGSQYTLAPLFLRL
FT                   SLINPLITTAAGTSIINSLLLFQGYSKLVARTNLINIVFYVLLLLFMLPKFSYIGYFIS
FT                   NWLGWIPGYIISLSFVKKNYNYKLPIKDVIKIYLATSIFLLPVLFINDMFGIVLDIFLI
FT                   IISYKIYVKIKIINQQEINIILSVVQNSSLNFIAGILKKILS"
     MSDLEKLGKN LTLNYVNLLQ GRFISHIIGF IGSILVIRIL EPADYGILSI AMSLPYTVSI        60
     FGNLGVNTAV TRFVAKYKEI DLTKAYSMIT SGMIFDVIYG ILLSVIGYLL TPYIFTYIYN       120
     KPEIIPYGEF ASFFTIPYWA SSSIFSGILG LELTKHNSEM WIIHYSVQTI LSVGLALSFL       180
     RVYGVIIGYI IGYTAIVIYG IVILKRKSLL GKPSINNMKE LVIFGFPLVL PSLGSSISGI       240
     YTTSLVNRFL SIFEISNLTA SSKLGTLFDT ILNPLSYALQ PTLSKLDRNK HDIVKVTNEL       300
     YKLNIILQLP ILISVEYLAY QIIYVLAGSQ YTLAPLFLRL SLINPLITTA AGTSIINSLL       360
     LFQGYSKLVA RTNLINIVFY VLLLLFMLPK FSYIGYFISN WLGWIPGYII SLSFVKKNYN       420
     YKLPIKDVIK IYLATSIFLL PVLFINDMFG IVLDIFLIII SYKIYVKIKI INQQEINIIL       480
     SVVQNSSLNF IAGILKKILS                                                   500
//

If you have problems or comments...

PBIL Back to PBIL home page